Sermorelin Acetate
In stock10 mg · Lyophilized powder
In stock · reserve now
Synthetic analog of GHRH (1–29).
Need larger quantities? Wholesale pricing for qualified businesses
or
For laboratory research use only by qualified researchers. Not for human or veterinary use. Not a drug, dietary supplement, cosmetic or food. Not evaluated by the FDA for any use.
How ordering works
This product is in stock. Reserve it now; no payment is collected today. Estimated availability is approximately 1–2 business days. We'll contact you when your reservation is ready for payment.
- 1Reserve todayNo payment now
- 2We confirm itAbout 1–2 business days
- 3Payment requestBy email, with a secure link
- 4ShipsTracking by email
Quick Summary
Formerly FDA-approved (Geref) — discontinuedSermorelin is a synthetic copy of the first 29 amino acids of growth hormone-releasing hormone (GHRH), the brain signal that tells the pituitary gland to release growth hormone. It was FDA-approved as Geref for testing and treating growth hormone deficiency in children, but the maker stopped selling it in 2008. No sermorelin product is currently FDA-approved.
Areas of research
- Pediatric growth hormone deficiency
- Pituitary function testing
- Age-related growth hormone decline
- Anti-doping science
- Amount
- 10 mg
- Form
- Lyophilized powder
- References
- 5 cited
- COA
- Batch report pending
- Free U.S. shipping on orders of $150 or more
- Lyophilized powder in a sealed vial
Research Use Notice. This product is intended for laboratory and research purposes. It is not intended for human consumption or personal medical use. Product information is provided for scientific and educational context only. See our Research Use Policy.
Why Researchers Study It
- Stimulating the body's own growth hormone release, one step upstream of growth hormone itself
- Pediatric growth hormone deficiency (former approved use)
- Pituitary function testing (former diagnostic use)
- Age-related decline in growth hormone, in small studies of older adults
What It Is
Sermorelin is a synthetic copy of the first 29 amino acids of human growth hormone-releasing hormone (GHRH), the brain signal that tells the pituit…
Sermorelin is a synthetic copy of the first 29 amino acids of human growth hormone-releasing hormone (GHRH), the brain signal that tells the pituitary gland to release growth hormone. This short piece is the smallest section known to keep the full activity of the natural hormone.
As sermorelin acetate, it was once an FDA-approved medicine sold by Serono under the brand name Geref.
The FDA approved Geref in 1990 as a diagnostic test of pituitary growth hormone output, and in 1997 for treating idiopathic growth hormone deficiency in children with growth failure. The manufacturer stopped selling both products in 2008, and approval was withdrawn in 2009. In 2013 the FDA formally determined the products were not withdrawn for reasons of safety or effectiveness.
Researchers have also studied it in older adults, because stimulating the body's own growth hormone release might keep more of the natural feedback control than giving growth hormone directly. That idea remains poorly tested.
How It Works
1 established · 2 proposed or under investigation
Established
- Stimulates growth hormone release from the anterior pituitary by acting like the natural hormone GHRH
Proposed / under investigation
- Because it acts upstream of growth hormone, the body's own feedback signals may still limit output (argued in reviews)
- Better preservation of natural, pulse-like growth hormone patterns than direct growth hormone injection (not firmly shown in trials)
Research Status & Evidence
Formerly FDA-approved (Geref) — discontinued
Approvals were withdrawn in 2009 after the manufacturer stopped selling it; FDA later determined this was not for safety or effectiveness reasons.
Types of evidence
- Not available: Cell & lab studies
- Available: Animal studies
- Not available: Early human studies
- Available: Clinical trials
- Available: Approved medical use
Sermorelin had a real regulatory approval, backed by pediatric trials in which height velocity improved over 12 months but was lower than with somatropin. Studies in older adults are small and short; one six-week study in 11 older men found no change in weight or DEXA-measured body composition. Long-term outcomes such as final adult height were never established.
Areas of research
- Pediatric growth hormone deficiencyformer approved indication (Geref)
- Pituitary function testingformer approved diagnostic use
- Age-related growth hormone declinesmall studies in older men
- Anti-doping sciencelisted by WADA as a GHRH analogue
Limitations
- No sermorelin product is currently FDA-approved; Geref approvals were withdrawn in 2009 after the maker discontinued them
- In children, growth responses were smaller than with standard growth hormone (somatropin)
- Evidence in adults is limited to small, short studies with mixed results
- Prohibited at all times in sport under the WADA Prohibited List
Specifications
10 mg · Lyophilized powder · CAS 86168-78-7
- Product
- Sermorelin Acetate
- Category
- Peptides
- Size
- 10 mg
- Form
- Lyophilized powder
- Synonyms
- Sermorelin; GHRH (1–29); GRF(1-29)NH2; GHRH(1-29)NH2; hGHRH(1-29)NH2; Groliberin
- CAS number
- 86168-78-7
- Molecular formula
- C149H246N44O42S
- Molecular weight
- 3357.9 g/mol
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
- PubChem CID
- 16132413
- SKU
- REN-SERM-10
Molecular data: Free peptide amide, not the acetate salt (PubChem).
Testing & COA Batch report pending
Research References (5)
Linked sources · last reviewed September 2026
- FDA. Determination that GEREF (sermorelin acetate) was not withdrawn from sale for reasons of safety or effectiveness. Federal Register 2013 · govinfo.gov
- Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic GH deficiency. BioDrugs 1999 · PubMed 18031173
- Vittone J et al. Effects of single nightly injections of GHRH (1-29) in healthy elderly men. Metabolism 1997 · PubMed 9005976
- Walker RF. Sermorelin: a better approach to management of adult-onset GH insufficiency? (editorial) Clin Interv Aging 2006 · dovepress.com
- WADA. The 2026 Prohibited List, section S2.2.4 (copy published by JADCO) · jadco.gov.jm
Summaries are written by Renuvia Labs from the sources above for educational context only. Last reviewed September 28, 2026.
Frequently Asked Questions
What is Sermorelin Acetate?
Sermorelin is a synthetic copy of the first 29 amino acids of growth hormone-releasing hormone (GHRH), the brain signal that tells the pituitary gland to release growth hormone. It was FDA-approved as Geref for testing and treating growth hormone deficiency in children, but the maker stopped selling it in 2008. No sermorelin product is currently FDA-approved.
Is there a Sermorelin Acetate coupon or discount code?
There is no public coupon code. New customers get a first-order discount for joining the Renuvia email list, volume pricing starts at 2 vials of Sermorelin Acetate, and U.S. shipping is free over $150. Codes on third-party coupon sites are not valid here.
What are other names for Sermorelin Acetate?
Sermorelin Acetate is also referred to as Sermorelin, GHRH (1–29), GRF(1-29)NH2, GHRH(1-29)NH2, hGHRH(1-29)NH2, Groliberin.
What are the CAS number and molecular weight of Sermorelin Acetate?
Sermorelin Acetate: CAS number 86168-78-7; molecular formula C149H246N44O42S; molecular weight 3357.9 g/mol; PubChem CID 16132413. Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2. (Free peptide amide, not the acetate salt (PubChem).)
What sizes is Renuvia Labs Sermorelin Acetate available in?
Sermorelin Acetate is listed in 10 mg, supplied as lyophilized powder in a sealed glass vial. It is sold for laboratory research use only.
Where is the Certificate of Analysis for Sermorelin Acetate?
Certificates of Analysis are published per lot in the Renuvia Labs COA library, searchable by product, SKU or lot number. Sermorelin Acetate shows "pending" there until the current lot's report exists; it is then linked on this page too.
Is this in stock?
Yes, unless the page says sold out. You reserve it with no payment today, and we email payment instructions in approximately 1–2 business days. Your order ships once payment arrives.
What form is this product supplied in?
Peptides and research compounds ship as lyophilized (freeze-dried) powder in a sealed glass vial. The fill amount printed on the product page and label is the total content of the vial.
Is this product for human use?
No. All Renuvia Labs products are sold strictly for laboratory research use. They are not for human or animal consumption and are not intended to diagnose, treat, cure or prevent any disease.
Do you offer volume pricing?
Yes. Per-vial pricing drops automatically at 2, 3 and 5 vials of the same product; the current tiers are shown next to the price. For larger quantities, see our wholesale program.
How much is shipping?
Free U.S. shipping on orders of $150 or more; $8.95 flat rate below that.
Do you ship outside the U.S.?
No. Renuvia Labs ships to U.S. addresses only. Research institutions outside the U.S. can enquire through the wholesale program.
